PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g044020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 334aa    MW: 37790.1 Da    PI: 5.2883
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g044020.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.51.1e-082693012355
                       SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
          Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       +yp++ee+ +L++ +gL+++q+ +WF N+R ++
  Sopen01g044020.1 269 PYPTEEEKNRLSEMTGLDQKQINNWFINQRKRH 301
                       8*****************************885 PP

2ELK38.72.1e-13221242122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELK++L+rKYsgyL+sL++EF+
  Sopen01g044020.1 221 ELKEMLMRKYSGYLSSLRKEFL 242
                       9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.3E-1773117IPR005540KNOX1
PfamPF037901.5E-1975115IPR005540KNOX1
SMARTSM012562.3E-26123174IPR005541KNOX2
PfamPF037918.5E-25126173IPR005541KNOX2
SMARTSM011881500132152IPR005539ELK domain
SMARTSM011883.1E-7221242IPR005539ELK domain
PfamPF037892.2E-10221242IPR005539ELK domain
PROSITE profilePS5121311.383221241IPR005539ELK domain
PROSITE profilePS5007112.795241304IPR001356Homeobox domain
SuperFamilySSF466891.11E-19243313IPR009057Homeodomain-like
SMARTSM003891.5E-12243308IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-26246306IPR009057Homeodomain-like
CDDcd000861.69E-12253305No hitNo description
PfamPF059203.2E-17261300IPR008422Homeobox KN domain
PROSITE patternPS000270279302IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MDELSKLHSA IVCSHSRRQQ EVEVEAEAGP TIVNNTTTSF AAVHHHYCQL EAAVAADHNH  60
HQNNSKSTTN MSDLIKAQIA NHPLYPNLLS AYLQCRKVGA PQEMTSILDE ISKENTLISS  120
SRHTSEIGAD PELDEFMESY CAVLVKYKEE FSKPFDEATS FLHNIESQLS SLCKDNLITS  180
TSFNNYISDE AGGTSDEDVG CEEMEAADSQ ESPANCEGDN ELKEMLMRKY SGYLSSLRKE  240
FLKKRKKGKL PKEARIVLLD WWKNHYRWPY PTEEEKNRLS EMTGLDQKQI NNWFINQRKR  300
HWRPSEDMKF ALMEGVSAGS MYFDGSGGTG NIGS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1236245LRKEFLKKRK
2242246KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3759680.0AF375968.1 Lycopersicon esculentum knotted homeodomain protein 4 (KN4) mRNA, partial cds.
GenBankAF5335970.0AF533597.1 Lycopersicon esculentum knotted protein TKN4 (kn4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015084672.10.0PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-100KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLQ84ZW20.0Q84ZW2_SOLLC; Knotted protein TKN4
STRINGSolyc01g100510.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.11e-76KNOTTED-like from Arabidopsis thaliana 2